Skip to Content

ELISA Recombinant Cryptococcus neoformans var. neoformans serotype D Protein YOP1(YOP1)

https://www.biometerpro.com/web/image/product.template/123098/image_1920?unique=c41145e
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans) Uniprot NO.:P0CN17 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAHSEQIKNNFLNNPYAQQVFNIANGQVSALDAELNKYPILRQLEQQTKVPKAYGVIAL GFSSVLLIFFNMFGLAQPISNLIGWALPAYLSILAIESPQTNDDKQWLTYWVVFGSLNLV ESMGLRAVLYWVPMYFVFKTLFTIWLmLPATRGAEILYFHFLRPMVGNVKSRSQSSFGTS DPLAKETGFNPAGTTAPSSFAHEKTL Protein Names:Recommended name: Protein YOP1 Gene Names:Name:YOP1 Ordered Locus Names:CNBF1120 Expression Region:1-206 Sequence Info:fµLl length protein

1,552.00 € 1552.0 EUR 1,552.00 €

1,552.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.