Skip to Content

ELISA Recombinant Arabidopsis thaliana ATP synthase protein MI25 (AtMg00640)

https://www.biometerpro.com/web/image/product.template/116514/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q04613 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLSITNMDGRKmLFAAILSICALSSKKILIYNEEMIVALCFIGFIIFSRKSLGTTFKVT LDGSLQAIQEELQQFPNPNEVVLLESNEQQRLLRISLRICGTVVESLPMARCAPKCEKTV QALLCRNLNVKLATLTNAISSRRIRFQDDLVTKFYTLVGKQFAYSCISKAERVEFIRESL VVLRMVRGGVFS Protein Names:Recommended name: ATP synthase protein MI25 Alternative name(s): ORF25 Gene Names:Ordered Locus Names:AtMg00640 Expression Region:1-192 Sequence Info:fµLl length protein

1,538.00 € 1538.0 EUR 1,538.00 €

1,538.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.