ELISA Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF19(ORF19)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus) Uniprot NO.:Q00136 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METMGPMVKSIWFWVIVLLVSGEGTDAVEIYWLELHESAVPCYGSKNTTMGDCLLAGGIL GLCGFEmLHRDTPLRRGVINKVSYRAVPRFMVFLSVMVTILHVLIITACLTIYIIAKVRS RCRRPIERTPDKPDPERVRLYLDSVRRRYWPCSGTEGDEDRTRLMPPGDRVEYDGREKLV RFSDVVTTHLLTDPGDGTYTIANE Protein Names:Recommended name: Putative membrane protein ORF19 Gene Names:Name:ORF19 Expression Region:1-204 Sequence Info:fµLl length protein