Skip to Content

ELISA Recombinant Macaca nemestrina G-protein coupled receptor 15(GPR15)

https://www.biometerpro.com/web/image/product.template/142601/image_1920?unique=62ab6da
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Macaca nemestrina (Pig-tailed macaque) Uniprot NO.:P56412 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDPEETSVYLDYYYATSPNPDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS VFLLTCMSVDRYLAIVCPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK PYCAEKKATPLKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI KIIFIVVAAFLVSWLPFNTSKLLAIVSGLQQERYFPSAILQLGMEVSGPLAFANSCVNPF IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFTRRRKRSVSL Protein Names:Recommended name: G-protein coupled receptor 15 Gene Names:Name:GPR15 Expression Region:1-360 Sequence Info:fµLl length protein

1,715.00 € 1715.0 EUR 1,715.00 €

1,715.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.