ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 3(PCR3)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P0CW97
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASQHLQANPHAEGEWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGA LYVLLAAITGCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYRELKHRGF DMSLGWAGNVEKQQNQGGVAMGAPAFQGGMSR
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 3 Short name= AtPCR3
Gene Names:Name:PCR3 Ordered Locus Names:At5g35525 ORF Names:MOK9
Expression Region:1-152
Sequence Info:fµLl length protein
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.