Skip to Content

ELISA Recombinant Mouse Palmitoyltransferase ZDHHC9(Zdhhc9)

https://www.biometerpro.com/web/image/product.template/145544/image_1920?unique=c91b609
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:P59268 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL AVQLSPAIPVFAAmLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ RPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPASTEHMNSNEMAEDTSIPEEMPPPEPPEPPQEAS EAEK Protein Names:Recommended name: Palmitoyltransferase ZDHHC9 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 9 Short name= DHHC-9 Short name= DHHC9 Gene Names:Name:Zdhhc9 Expression Region:1-364 Sequence Info:FµLl length protein

1,719.00 € 1719.0 EUR 1,719.00 €

1,719.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.