ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 5(PCR5)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LS45
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGRPVGQTNQAQPSVQHTASPSNKVSHNGGIGKPANIPTGIPVNYQQTQNQWSSQLFDCM NDSENAVITLIAPCVTFGQIAEIVDEGATPCATAGLLYGALFFTGASFVYSYMFRARIRK KFGLPDAPAPDWITHLVCMPFALCQEYRELKHHGFDPILGWAGNVQQAQQQEMMTPPTGQ RMMG
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 5 Short name= AtPCR5
Gene Names:Name:PCR5 Ordered Locus Names:At3g18450 ORF Names:MYF24.17
Expression Region:1-184
Sequence Info:fµLl length protein
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.